Lineage for d1alo_3 (1alo 194-310)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79412Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
  4. 79413Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 79414Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (3 proteins)
  6. 79415Protein Aldehyde oxidoreductase, domain 3 [54667] (2 species)
  7. 79418Species Desulfovibrio gigas [TaxId:879] [54668] (1 PDB entry)
  8. 79419Domain d1alo_3: 1alo 194-310 [38584]
    Other proteins in same PDB: d1alo_1, d1alo_2, d1alo_4

Details for d1alo_3

PDB Entry: 1alo (more details), 2 Å

PDB Description: aldehyde oxidoreductase
PDB Compounds: ( :)

SCOP Domain Sequences for d1alo_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alo_3 d.41.1.1 (194-310) Aldehyde oxidoreductase, domain 3 {Desulfovibrio gigas}
dygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvithkdvkgknritg
litfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekvkvdleelpay

SCOP Domain Coordinates for d1alo_3:

Click to download the PDB-style file with coordinates for d1alo_3.
(The format of our PDB-style files is described here.)

Timeline for d1alo_3: