Lineage for d1alo_4 (1alo 311-907)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84084Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
  4. 84085Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
  5. 84086Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (3 proteins)
  6. 84087Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 84090Species Desulfovibrio gigas [TaxId:879] [56006] (1 PDB entry)
  8. 84091Domain d1alo_4: 1alo 311-907 [41414]
    Other proteins in same PDB: d1alo_1, d1alo_2, d1alo_3

Details for d1alo_4

PDB Entry: 1alo (more details), 2 Å

PDB Description: aldehyde oxidoreductase
PDB Compounds: ( :)

SCOP Domain Sequences for d1alo_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1alo_4 d.133.1.1 (311-907) Aldehyde oxidoreductase {Desulfovibrio gigas}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsreqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOP Domain Coordinates for d1alo_4:

Click to download the PDB-style file with coordinates for d1alo_4.
(The format of our PDB-style files is described here.)

Timeline for d1alo_4: