SCOPe 2.08: Domain d3k3ub_: 3k3u B:

Lineage for d3k3ub_ (3k3u B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)

8. Domain d3k3ub_: 3k3u B: [179049]
   automated match to d1ew6a_
   complexed with hem, so4; mutant

Details for d3k3ub_

PDB Entry: 3k3u, 1.63 Å

PDB Description: the v59w mutation blocks the distal pocket of the hemoglobin dehaloperoxidase from amphitrite ornata

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3k3ub_:

Sequence; same for both SEQRES and ATOM records:

>d3k3ub_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekwf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3k3ub_:

• d3k3ub_ first appeared in SCOPe 2.01
  
• d3k3ub_ appears in SCOPe 2.07