Lineage for d3k3ab_ (3k3a B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959648Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 959649Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 959650Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 959827Protein automated matches [190279] (4 species)
    not a true protein
  7. 959864Species Influenza b virus [TaxId:343983] [189447] (5 PDB entries)
  8. 959902Domain d3k3ab_: 3k3a B: [179021]
    automated match to d1a4ga_
    complexed with ca, g39, nag, yt3; mutant

Details for d3k3ab_

PDB Entry: 3k3a (more details), 2.59 Å

PDB Description: crystal structure of b/perth neuraminidase d197e mutant in complex with oseltamivir
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d3k3ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k3ab_ b.68.1.1 (B:) automated matches {Influenza b virus [TaxId: 343983]}
pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
whsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d3k3ab_:

Click to download the PDB-style file with coordinates for d3k3ab_.
(The format of our PDB-style files is described here.)

Timeline for d3k3ab_: