Lineage for d1huub_ (1huu B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493154Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 1493155Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 1493156Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 1493157Protein HU protein [47735] (5 species)
  7. 1493167Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries)
  8. 1493169Domain d1huub_: 1huu B: [17898]

Details for d1huub_

PDB Entry: 1huu (more details), 2 Å

PDB Description: dna-binding protein hu from bacillus stearothermophilus
PDB Compounds: (B:) protein hu

SCOPe Domain Sequences for d1huub_:

Sequence, based on SEQRES records: (download)

>d1huub_ a.55.1.1 (B:) HU protein {Bacillus stearothermophilus [TaxId: 1422]}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
rnpqtgeemeipaskvpafkpgkalkdavk

Sequence, based on observed residues (ATOM records): (download)

>d1huub_ a.55.1.1 (B:) HU protein {Bacillus stearothermophilus [TaxId: 1422]}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraaskv
pafkpgkalkdavk

SCOPe Domain Coordinates for d1huub_:

Click to download the PDB-style file with coordinates for d1huub_.
(The format of our PDB-style files is described here.)

Timeline for d1huub_: