![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
![]() | Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
![]() | Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) automatically mapped to Pfam PF00216 |
![]() | Protein HU protein [47735] (5 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries) |
![]() | Domain d1huub_: 1huu B: [17898] |
PDB Entry: 1huu (more details), 2 Å
SCOPe Domain Sequences for d1huub_:
Sequence, based on SEQRES records: (download)
>d1huub_ a.55.1.1 (B:) HU protein {Bacillus stearothermophilus [TaxId: 1422]} mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg rnpqtgeemeipaskvpafkpgkalkdavk
>d1huub_ a.55.1.1 (B:) HU protein {Bacillus stearothermophilus [TaxId: 1422]} mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraaskv pafkpgkalkdavk
Timeline for d1huub_: