SCOPe 2.02: Domain d3jxsb_: 3jxs B:

Lineage for d3jxsb_ (3jxs B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.14: CBM4/9 [74893] (4 proteins)

6. Protein automated matches [191099] (1 species)
   not a true protein

7. Species Rhodothermus marinus [TaxId:29549] [189091] (7 PDB entries)

8. Domain d3jxsb_: 3jxs B: [178915]
   automated match to d1k42a_
   complexed with act, ca

Details for d3jxsb_

PDB Entry: 3jxs, 1.6 Å

PDB Description: crystal structure of xg34, an evolved xyloglucan binding cbm

PDB Compounds: (B:) xylanase

SCOPe Domain Sequences for d3jxsb_:

Sequence; same for both SEQRES and ATOM records:

>d3jxsb_ b.18.1.14 (B:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpydihatalpvnvrpgvtytytiwaraeqdgavvsftvgnqshddygrlheqq
ittewqpftfeftvsdqetvirapihfgfaanvgntiyidglaivd

Timeline for d3jxsb_:

• d3jxsb_ first appeared in SCOPe 2.01
  
• d3jxsb_ appears in SCOPe 2.03
  
• d3jxsb_ appears in the current release, SCOPe 2.08