| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.14: CBM4/9 [74893] (4 proteins) |
| Protein automated matches [191099] (1 species) not a true protein |
| Species Rhodothermus marinus [TaxId:29549] [189091] (9 PDB entries) |
| Domain d3jxsb_: 3jxs B: [178915] automated match to d1k42a_ complexed with act, ca |
PDB Entry: 3jxs (more details), 1.6 Å
SCOPe Domain Sequences for d3jxsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jxsb_ b.18.1.14 (B:) automated matches {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpydihatalpvnvrpgvtytytiwaraeqdgavvsftvgnqshddygrlheqq
ittewqpftfeftvsdqetvirapihfgfaanvgntiyidglaivd
Timeline for d3jxsb_: