Lineage for d3jv1a_ (3jv1 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548370Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily)
    core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain
  4. 2548371Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (2 families) (S)
  5. 2548389Family d.25.1.0: automated matches [191628] (1 protein)
    not a true family
  6. 2548390Protein automated matches [191151] (1 species)
    not a true protein
  7. 2548391Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189305] (1 PDB entry)
  8. 2548392Domain d3jv1a_: 3jv1 A: [178843]
    automated match to d1yqfa1

Details for d3jv1a_

PDB Entry: 3jv1 (more details), 2 Å

PDB Description: Crystal structure of the Trypanosoma brucei p22 protein
PDB Compounds: (A:) P22 protein

SCOPe Domain Sequences for d3jv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jv1a_ d.25.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
avsdqrlseatlrelederqraglpekpeipegwtidrkpgvthftmrkshgdeeiilql
tgedrsneeitrtldvlvvnggkalvfgmsvedgefvinnvcfrhdgklaldtsaeaqfq
ksqlymgpdladledhlvdsftsylsargvndtlanfidqfslwseqadyeewlssinkf
vs

SCOPe Domain Coordinates for d3jv1a_:

Click to download the PDB-style file with coordinates for d3jv1a_.
(The format of our PDB-style files is described here.)

Timeline for d3jv1a_: