Lineage for d1yqfa1 (1yqf A:14-195)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548370Fold d.25: Mitochondrial glycoprotein MAM33-like [54528] (1 superfamily)
    core: beta(7)-alpha(2); N- and C-terminal extensions form a coiled coil subdomain
  4. 2548371Superfamily d.25.1: Mitochondrial glycoprotein MAM33-like [54529] (2 families) (S)
  5. 2548372Family d.25.1.1: Mitochondrial glycoprotein MAM33-like [54530] (2 proteins)
  6. 2548381Protein Hypothetical protein Lmaj011689 [143110] (1 species)
  7. 2548382Species Leishmania major [TaxId:5664] [143111] (1 PDB entry)
    Uniprot Q4Q7K6 14-195
  8. 2548383Domain d1yqfa1: 1yqf A:14-195 [123880]

Details for d1yqfa1

PDB Entry: 1yqf (more details), 2.3 Å

PDB Description: hypothetical protein from leishmania major unknown function sequence homologue to human p32 protein
PDB Compounds: (A:) hypothetical protein Lmaj011689

SCOPe Domain Sequences for d1yqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqfa1 d.25.1.1 (A:14-195) Hypothetical protein Lmaj011689 {Leishmania major [TaxId: 5664]}
asdaaladatrreleeemgrsdkpeqptppagwqvvrkpgtctfdltksfegedlvvrys
tnqdsdkanshnifvyitqkngqtmqadlsieegelvlnnirfydeaalakdtgaeaeak
rnelytgplvheldydllncvmtylekrgvdeklgefvvlysfwaeqqdyeawlttmnkf
as

SCOPe Domain Coordinates for d1yqfa1:

Click to download the PDB-style file with coordinates for d1yqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1yqfa1: