SCOPe 2.06: Domain d3jtga_: 3jtg A:

Lineage for d3jtga_ (3jtg A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189188] (1 PDB entry)

8. Domain d3jtga_: 3jtg A: [178823]
   automated match to d1wwxa1
   protein/DNA complex

Details for d3jtga_

PDB Entry: 3jtg, 2.2 Å

PDB Description: Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA

PDB Compounds: (A:) ETS-related transcription factor Elf-3

SCOPe Domain Sequences for d3jtga_:

Sequence; same for both SEQRES and ATOM records:

>d3jtga_ a.4.5.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gthlwefirdilihpelneglmkwenrhegvfkflrseavaqlwgqkkknsnmtyeklsr
amryyykreilervdgrrlvykfgknssgwkeeev

Timeline for d3jtga_:

• d3jtga_ first appeared in SCOPe 2.01
  
• d3jtga_ appears in SCOPe 2.05
  
• d3jtga_ appears in SCOPe 2.07
  
• d3jtga_ appears in the current release, SCOPe 2.08