Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.21: ets domain [46859] (9 proteins) |
Protein automated matches [191121] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189188] (1 PDB entry) |
Domain d3jtga_: 3jtg A: [178823] automated match to d1wwxa1 protein/DNA complex |
PDB Entry: 3jtg (more details), 2.2 Å
SCOPe Domain Sequences for d3jtga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jtga_ a.4.5.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gthlwefirdilihpelneglmkwenrhegvfkflrseavaqlwgqkkknsnmtyeklsr amryyykreilervdgrrlvykfgknssgwkeeev
Timeline for d3jtga_: