Lineage for d3jtga_ (3jtg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306061Family a.4.5.21: ets domain [46859] (9 protein domains)
  6. 2306107Protein automated matches [191121] (2 species)
    not a true protein
  7. 2306131Species Mouse (Mus musculus) [TaxId:10090] [189188] (1 PDB entry)
  8. 2306132Domain d3jtga_: 3jtg A: [178823]
    automated match to d1wwxa1
    protein/DNA complex

Details for d3jtga_

PDB Entry: 3jtg (more details), 2.2 Å

PDB Description: Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA
PDB Compounds: (A:) ETS-related transcription factor Elf-3

SCOPe Domain Sequences for d3jtga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jtga_ a.4.5.21 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gthlwefirdilihpelneglmkwenrhegvfkflrseavaqlwgqkkknsnmtyeklsr
amryyykreilervdgrrlvykfgknssgwkeeev

SCOPe Domain Coordinates for d3jtga_:

Click to download the PDB-style file with coordinates for d3jtga_.
(The format of our PDB-style files is described here.)

Timeline for d3jtga_: