Lineage for d3jsef_ (3jse F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995759Species Thermoplasma acidophilum [TaxId:2303] [186869] (4 PDB entries)
  8. 2995807Domain d3jsef_: 3jse F: [178763]
    Other proteins in same PDB: d3jseh_, d3jsei_, d3jsej_, d3jsek_, d3jsel_, d3jsem_, d3jsen_, d3jseo_, d3jsep_, d3jseq_, d3jser_, d3jses_, d3jset_, d3jseu_
    automated match to d1pmaa_

Details for d3jsef_

PDB Entry: 3jse (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (F:) Proteasome subunit alpha

SCOPe Domain Sequences for d3jsef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jsef_ d.153.1.4 (F:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d3jsef_:

Click to download the PDB-style file with coordinates for d3jsef_.
(The format of our PDB-style files is described here.)

Timeline for d3jsef_: