| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein automated matches [190144] (6 species) not a true protein |
| Species Thermoplasma acidophilum [TaxId:2303] [186869] (5 PDB entries) |
| Domain d3jrmc_: 3jrm C: [178726] Other proteins in same PDB: d3jrmh_, d3jrmi_, d3jrmj_, d3jrmk_, d3jrml_, d3jrmm_, d3jrmn_, d3jrmo_, d3jrmp_, d3jrmq_, d3jrmr_, d3jrms_, d3jrmt_, d3jrmu_ automated match to d1pmaa_ |
PDB Entry: 3jrm (more details), 2.9 Å
SCOPe Domain Sequences for d3jrmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jrmc_ d.153.1.4 (C:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
aydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiek
iqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqy
ggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpe
keavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
Timeline for d3jrmc_: