SCOPe 2.06: Domain d3jr8a_: 3jr8 A:

Lineage for d3jr8a_ (3jr8 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (7 PDB entries)

8. Domain d3jr8a_: 3jr8 A: [178718]
   automated match to d1gmza_
   complexed with ca

Details for d3jr8a_

PDB Entry: 3jr8, 2.1 Å

PDB Description: Crystal Structure of BthTX-II (Asp49-PLA2 from Bothrops jararacussu snake venom) with calcium ions

PDB Compounds: (A:) Phospholipase A2 bothropstoxin-2

SCOPe Domain Sequences for d3jr8a_:

Sequence; same for both SEQRES and ATOM records:

>d3jr8a_ a.133.1.2 (A:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
dlwqfgqmilketgklpfpyyttygcycgwggqgqpkdatdrccfvhdccygkltnckpk
tdrysysrengviicgegtpcekqicecdkaaavcfrenlrtykkrymaypdvlckkpae
kc

Timeline for d3jr8a_:

• d3jr8a_ first appeared in SCOPe 2.01
  
• d3jr8a_ appears in SCOPe 2.05
  
• d3jr8a_ appears in SCOPe 2.07
  
• d3jr8a_ appears in the current release, SCOPe 2.08