Lineage for d3jr2b_ (3jr2 B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143706Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1144315Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 1144316Protein automated matches [190292] (10 species)
    not a true protein
  7. 1144367Species Vibrio cholerae [TaxId:666] [189015] (2 PDB entries)
  8. 1144369Domain d3jr2b_: 3jr2 B: [178714]
    automated match to d1kv8a_
    complexed with edo, gol, mg, so4

Details for d3jr2b_

PDB Entry: 3jr2 (more details), 1.8 Å

PDB Description: x-ray crystal structure of the mg-bound 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
PDB Compounds: (B:) Hexulose-6-phosphate synthase SgbH

SCOPe Domain Sequences for d3jr2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jr2b_ c.1.2.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
kpmiqialdqtnltdavavasnvasyvdvievgtilafaegmkavstlrhnhpnhilvcd
mkttdggailsrmafeagadwitvsaaahiatiaackkvadelngeiqieiygnwtmqda
kawvdlgitqaiyhrsrdaelagigwttddldkmrqlsalgielsitggivpediylfeg
iktktfiagralagaegqqtaaalreqidrfwp

SCOPe Domain Coordinates for d3jr2b_:

Click to download the PDB-style file with coordinates for d3jr2b_.
(The format of our PDB-style files is described here.)

Timeline for d3jr2b_: