Lineage for d3iwla_ (3iwl A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653690Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1653691Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1653692Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 1653711Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (10 PDB entries)
    Uniprot O00244
  8. 1653712Domain d3iwla_: 3iwl A: [178652]
    automated match to d1fe0b_
    complexed with pt, so4, tce

Details for d3iwla_

PDB Entry: 3iwl (more details), 1.6 Å

PDB Description: crystal structure of cisplatin bound to a human copper chaperone (monomer)
PDB Compounds: (A:) copper transport protein atox1

SCOPe Domain Sequences for d3iwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwla_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgl

SCOPe Domain Coordinates for d3iwla_:

Click to download the PDB-style file with coordinates for d3iwla_.
(The format of our PDB-style files is described here.)

Timeline for d3iwla_: