| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein automated matches [190204] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries) |
| Domain d3it8c_: 3it8 C: [178609] automated match to d1tnfa_ complexed with nag |
PDB Entry: 3it8 (more details), 2.8 Å
SCOPe Domain Sequences for d3it8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3it8c_ b.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyllfaesgqvyfgiial
Timeline for d3it8c_: