Lineage for d3it8i_ (3it8 I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777555Protein automated matches [190204] (3 species)
    not a true protein
  7. 2777556Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries)
  8. 2777580Domain d3it8i_: 3it8 I: [178612]
    automated match to d1tnfa_
    complexed with nag

Details for d3it8i_

PDB Entry: 3it8 (more details), 2.8 Å

PDB Description: crystal structure of tnf alpha complexed with a poxvirus mhc-related tnf binding protein
PDB Compounds: (I:) Tumor necrosis factor

SCOPe Domain Sequences for d3it8i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3it8i_ b.22.1.1 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyllfaesgqvyfgiial

SCOPe Domain Coordinates for d3it8i_:

Click to download the PDB-style file with coordinates for d3it8i_.
(The format of our PDB-style files is described here.)

Timeline for d3it8i_: