SCOPe 2.07: Domain d3iswb_: 3isw B:

Lineage for d3iswb_ (3isw B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein automated matches [190375] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187222] (4 PDB entries)

8. Domain d3iswb_: 3isw B: [178606]
   automated match to d2brqa1

Details for d3iswb_

PDB Entry: 3isw, 2.8 Å

PDB Description: crystal structure of filamin-a immunoglobulin-like repeat 21 bound to an n-terminal peptide of cftr

PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d3iswb_:

Sequence; same for both SEQRES and ATOM records:

>d3iswb_ b.1.18.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

Timeline for d3iswb_:

• d3iswb_ first appeared in SCOPe 2.01
  
• d3iswb_ appears in SCOPe 2.06
  
• d3iswb_ appears in the current release, SCOPe 2.08