Lineage for d3iswb_ (3isw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765751Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2765806Protein automated matches [190375] (1 species)
    not a true protein
  7. 2765807Species Human (Homo sapiens) [TaxId:9606] [187222] (3 PDB entries)
  8. 2765811Domain d3iswb_: 3isw B: [178606]
    automated match to d2brqa1

Details for d3iswb_

PDB Entry: 3isw (more details), 2.8 Å

PDB Description: crystal structure of filamin-a immunoglobulin-like repeat 21 bound to an n-terminal peptide of cftr
PDB Compounds: (B:) Filamin-A

SCOPe Domain Sequences for d3iswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iswb_ b.1.18.10 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggahkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgv
ayvvqepgdyevsvkfneehipdspfvvpvasps

SCOPe Domain Coordinates for d3iswb_:

Click to download the PDB-style file with coordinates for d3iswb_.
(The format of our PDB-style files is described here.)

Timeline for d3iswb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3iswa_