| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (6 PDB entries) |
| Domain d3iqla1: 3iql A:291-352 [178559] Other proteins in same PDB: d3iqla2, d3iqlb2 automated match to d1k76a_ complexed with cl |
PDB Entry: 3iql (more details), 1.4 Å
SCOPe Domain Sequences for d3iqla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iqla1 b.34.2.0 (A:291-352) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyveilval
ph
Timeline for d3iqla1: