Lineage for d3iqla1 (3iql A:291-352)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783658Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (6 PDB entries)
  8. 2783661Domain d3iqla1: 3iql A:291-352 [178559]
    Other proteins in same PDB: d3iqla2, d3iqlb2
    automated match to d1k76a_
    complexed with cl

Details for d3iqla1

PDB Entry: 3iql (more details), 1.4 Å

PDB Description: Crystal structure of the rat endophilin-A1 SH3 domain
PDB Compounds: (A:) Endophilin-A1

SCOPe Domain Sequences for d3iqla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqla1 b.34.2.0 (A:291-352) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyveilval
ph

SCOPe Domain Coordinates for d3iqla1:

Click to download the PDB-style file with coordinates for d3iqla1.
(The format of our PDB-style files is described here.)

Timeline for d3iqla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iqla2