SCOPe 2.07: Domain d3iqla1: 3iql A:291-352

Lineage for d3iqla1 (3iql A:291-352)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (5 PDB entries)

8. Domain d3iqla1: 3iql A:291-352 [178559]
   Other proteins in same PDB: d3iqla2, d3iqlb2
   automated match to d1k76a_
   complexed with cl

Details for d3iqla1

PDB Entry: 3iql, 1.4 Å

PDB Description: Crystal structure of the rat endophilin-A1 SH3 domain

PDB Compounds: (A:) Endophilin-A1

SCOPe Domain Sequences for d3iqla1:

Sequence; same for both SEQRES and ATOM records:

>d3iqla1 b.34.2.0 (A:291-352) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyveilval
ph

Timeline for d3iqla1:

• d3iqla1 first appeared in SCOPe 2.01, called d3iqla_
  
• d3iqla1 appears in SCOPe 2.06
  
• d3iqla1 appears in the current release, SCOPe 2.08