Lineage for d3iqla_ (3iql A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946580Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 946581Protein automated matches [190457] (5 species)
    not a true protein
  7. 946619Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (1 PDB entry)
  8. 946620Domain d3iqla_: 3iql A: [178559]
    automated match to d1k76a_
    complexed with cl

Details for d3iqla_

PDB Entry: 3iql (more details), 1.4 Å

PDB Description: Crystal structure of the rat endophilin-A1 SH3 domain
PDB Compounds: (A:) Endophilin-A1

SCOPe Domain Sequences for d3iqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqla_ b.34.2.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
svgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyvei
lvalph

SCOPe Domain Coordinates for d3iqla_:

Click to download the PDB-style file with coordinates for d3iqla_.
(The format of our PDB-style files is described here.)

Timeline for d3iqla_: