| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (5 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (1 PDB entry) |
| Domain d3iqla_: 3iql A: [178559] automated match to d1k76a_ complexed with cl |
PDB Entry: 3iql (more details), 1.4 Å
SCOPe Domain Sequences for d3iqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iqla_ b.34.2.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
svgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyvei
lvalph
Timeline for d3iqla_: