SCOPe 2.02: Domain d3ipre_: 3ipr E:

Lineage for d3ipre_ (3ipr E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (3 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [189023] (1 PDB entry)

8. Domain d3ipre_: 3ipr E: [178508]
   automated match to d1pdoa_
   complexed with ca

Details for d3ipre_

PDB Entry: 3ipr, 2.5 Å

PDB Description: Crystal structure of the Enterococcus faecalis gluconate specific EIIA phosphotransferase system component

PDB Compounds: (E:) PTS system, IIA component

SCOPe Domain Sequences for d3ipre_:

Sequence; same for both SEQRES and ATOM records:

>d3ipre_ c.54.1.0 (E:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mlgiviathgalsdgakdaatvimgatenietvnlnsgddvqalggqiktaienvqqgdg
vlvmvdllsaspynqavlvinelepalqkkifvvsgtnlpmvleainhqllgtpiaeaaq
aivaqgkesvqawdismtsf

Timeline for d3ipre_:

• d3ipre_ first appeared in SCOPe 2.01
  
• d3ipre_ appears in SCOPe 2.03
  
• d3ipre_ appears in the current release, SCOPe 2.08