Lineage for d3ipre_ (3ipr E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883312Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883313Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2883344Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. 2883345Protein automated matches [190395] (8 species)
    not a true protein
  7. 2883346Species Enterococcus faecalis [TaxId:1351] [189023] (1 PDB entry)
  8. 2883351Domain d3ipre_: 3ipr E: [178508]
    automated match to d1pdoa_
    complexed with ca

Details for d3ipre_

PDB Entry: 3ipr (more details), 2.5 Å

PDB Description: Crystal structure of the Enterococcus faecalis gluconate specific EIIA phosphotransferase system component
PDB Compounds: (E:) PTS system, IIA component

SCOPe Domain Sequences for d3ipre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ipre_ c.54.1.0 (E:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mlgiviathgalsdgakdaatvimgatenietvnlnsgddvqalggqiktaienvqqgdg
vlvmvdllsaspynqavlvinelepalqkkifvvsgtnlpmvleainhqllgtpiaeaaq
aivaqgkesvqawdismtsf

SCOPe Domain Coordinates for d3ipre_:

Click to download the PDB-style file with coordinates for d3ipre_.
(The format of our PDB-style files is described here.)

Timeline for d3ipre_: