Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) |
Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein) Pfam PF02686 |
Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species) |
Species Staphylococcus aureus [TaxId:158878] [189133] (1 PDB entry) |
Domain d3ip4c_: 3ip4 C: [178498] Other proteins in same PDB: d3ip4a_ automated match to d2df4c1 complexed with mg |
PDB Entry: 3ip4 (more details), 1.9 Å
SCOPe Domain Sequences for d3ip4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ip4c_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 158878]} kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv lredkaikgipqelalknaketedgqfkvpti
Timeline for d3ip4c_: