SCOPe 2.07: Domain d3ip4c_: 3ip4 C:

Lineage for d3ip4c_ (3ip4 C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)

7. Species Staphylococcus aureus [TaxId:158878] [189133] (1 PDB entry)

8. Domain d3ip4c_: 3ip4 C: [178498]
   Other proteins in same PDB: d3ip4a_
   automated match to d2df4c1
   complexed with mg

Details for d3ip4c_

PDB Entry: 3ip4, 1.9 Å

PDB Description: The high resolution structure of GatCAB

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d3ip4c_:

Sequence; same for both SEQRES and ATOM records:

>d3ip4c_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 158878]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvpti

Timeline for d3ip4c_:

• d3ip4c_ first appeared in SCOPe 2.01
  
• d3ip4c_ appears in SCOPe 2.06
  
• d3ip4c_ appears in the current release, SCOPe 2.08