Lineage for d3ip4c_ (3ip4 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734134Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) (S)
  5. 2734135Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
    Pfam PF02686
  6. 2734136Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)
  7. 2734143Species Staphylococcus aureus [TaxId:158878] [189133] (1 PDB entry)
  8. 2734144Domain d3ip4c_: 3ip4 C: [178498]
    Other proteins in same PDB: d3ip4a_
    automated match to d2df4c1
    complexed with mg

Details for d3ip4c_

PDB Entry: 3ip4 (more details), 1.9 Å

PDB Description: The high resolution structure of GatCAB
PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d3ip4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ip4c_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 158878]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvpti

SCOPe Domain Coordinates for d3ip4c_:

Click to download the PDB-style file with coordinates for d3ip4c_.
(The format of our PDB-style files is described here.)

Timeline for d3ip4c_: