Lineage for d3in8a_ (3in8 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206461Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2206615Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2206616Species Human (Homo sapiens) [TaxId:9606] [55564] (35 PDB entries)
  8. 2206619Domain d3in8a_: 3in8 A: [178439]
    automated match to d1fhsa_
    complexed with fmt, fyi

Details for d3in8a_

PDB Entry: 3in8 (more details), 1.7 Å

PDB Description: crystal structure of the grb2 sh2 domain in complex with a flexible ac-ptyr-ile-asn-nh2 tripeptide mimic
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d3in8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3in8a_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp

SCOPe Domain Coordinates for d3in8a_:

Click to download the PDB-style file with coordinates for d3in8a_.
(The format of our PDB-style files is described here.)

Timeline for d3in8a_: