PDB entry 3in8

View 3in8 on RCSB PDB site
Description: Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2 Tripeptide Mimic
Class: signaling protein/peptide
Keywords: ligand preorganization, Golgi apparatus, PEPTIDE MIMICS, Host-virus interaction, Phosphoprotein, SH2 domain, SH3, SIGNALING PROTEIN, SIGNALING PROTEIN-pseudopeptide ligand complex,SIGNALING PROTEIN-PEPTIDE COMPLEX, SIGNALING PROTEIN-PEPTIDE complex
Deposited on 2009-08-11, released 2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3in8a_
  • Heterogens: FYI, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3in8A (A:)
    iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
    dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3in8A (A:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp