PDB entry 3in8
View 3in8 on RCSB PDB site
Description: Crystal Structure of the Grb2 SH2 Domain in Complex with a Flexible Ac-pTyr-Ile-Asn-NH2 Tripeptide Mimic
Class: signaling protein/peptide
Keywords: ligand preorganization, Golgi apparatus, PEPTIDE MIMICS, Host-virus interaction, Phosphoprotein, SH2 domain, SH3, SIGNALING PROTEIN, SIGNALING PROTEIN-pseudopeptide ligand complex,SIGNALING PROTEIN-PEPTIDE COMPLEX, SIGNALING PROTEIN-PEPTIDE complex
Deposited on
2009-08-11, released
2009-11-17
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Growth factor receptor-bound protein 2
Species: Homo sapiens [TaxId:9606]
Gene: GRB2, ASH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3in8a_ - Heterogens: FYI, FMT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3in8A (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3in8A (A:)
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp