| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) ![]() dimer of identical alpha-hairpin motifs |
| Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
| Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries) Uniprot P00514 12-61 |
| Domain d3im4a_: 3im4 A: [178394] automated match to d2ezwa1 complexed with zn |
PDB Entry: 3im4 (more details), 2.29 Å
SCOPe Domain Sequences for d3im4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3im4a_ a.31.1.1 (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak
Timeline for d3im4a_: