Lineage for d3im4a_ (3im4 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993555Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 1993556Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 1993557Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 protein domains)
  6. 1993558Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)
  7. 1993559Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
    Uniprot P00514 12-61
  8. 1993561Domain d3im4a_: 3im4 A: [178394]
    automated match to d2ezwa1
    complexed with zn

Details for d3im4a_

PDB Entry: 3im4 (more details), 2.29 Å

PDB Description: Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in complex with dual-specific A-Kinase Anchoring Protein 2
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d3im4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3im4a_ a.31.1.1 (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

SCOPe Domain Coordinates for d3im4a_:

Click to download the PDB-style file with coordinates for d3im4a_.
(The format of our PDB-style files is described here.)

Timeline for d3im4a_: