PDB entry 3im4

View 3im4 on RCSB PDB site
Description: Crystal structure of cAMP-dependent Protein Kinase A Regulatory Subunit I alpha in complex with dual-specific A-Kinase Anchoring Protein 2
Class: structural protein, signaling protein
Keywords: four-helix bundle, Acetylation, cAMP, cAMP-binding, Disulfide bond, Nucleotide-binding, Phosphoprotein, Cytoplasm, Membrane, Mitochondrion, Polymorphism, Transit peptide, STRUCTURAL PROTEIN, SIGNALING PROTEIN
Deposited on 2009-08-09, released 2010-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3im4a_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Bos taurus [TaxId:9913]
    Gene: PRKAR1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3im4b_
  • Chain 'C':
    Compound: Dual specificity A kinase-anchoring protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: AKAP10
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43572
      • natural variant (28)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3im4A (A:)
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3im4B (B:)
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

    Sequence, based on observed residues (ATOM records): (download) 
    >3im4B (B:)
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeea

  • Chain 'C':
    No sequence available.