Lineage for d1bfaa_ (1bfa A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
4 helices; folded leaf; right-handed superhelixSuperfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) 
can be classified as disulfide-rich
Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins) Protein Hageman factor/amylase inhibitor [47713] (1 species) Species Maize (Zea mays) [TaxId:4577] [47714] (2 PDB entries) 
Domain d1bfaa_: 1bfa A: [17827]
Details for d1bfaa_
PDB Entry: 1bfa (more details), 2.2 Å
PDB Description: recombinant bifunctional hageman factor/amylase inhibitor from maize
PDB Compounds: (A:) bifunctional amylase/serine protease inhibitorSCOPe Domain Sequences for d1bfaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfaa_ a.52.1.2 (A:) Hageman factor/amylase inhibitor {Maize (Zea mays) [TaxId: 4577]}
scvpgwaiphnplpscrwyvtsrtcgigprlpwpelkrrccreladipaycrctalsilm
dgaippgpdaqlegrledlpgcprevqrgfaatlvteaecnlatisgvaecpwilg
SCOPe Domain Coordinates for d1bfaa_:
Click to download the PDB-style file with coordinates for d1bfaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bfaa_:
- d1bfaa_ first appeared (with stable ids) in SCOP 1.55, called d1bfa__
- d1bfaa_ appears in SCOPe 2.07
View in 3D