PDB entry 1bfa

View 1bfa on RCSB PDB site
Description: recombinant bifunctional hageman factor/amylase inhibitor from maize
Class: serine protease inhibitor
Keywords: serine protease inhibitor, amylase/protease bifunctional inhibitor
Deposited on 1998-05-13, released 1998-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional amylase/serine protease inhibitor
    Species: Zea mays [TaxId:4577]
    Gene: 7N-CHFI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bfaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1bfaA (A:)
maripmasagtscvpgwaiphnplpscrwyvtsrtcgigprlpwpelkrrccreladipa
ycrctalsilmdgaippgpdaqlegrledlpgcprevqrgfaatlvteaecnlatisgva
ecpwilgggtmpsk

    Sequence, based on observed residues (ATOM records): (download) 
    >1bfaA (A:)
scvpgwaiphnplpscrwyvtsrtcgigprlpwpelkrrccreladipaycrctalsilm
dgaippgpdaqlegrledlpgcprevqrgfaatlvteaecnlatisgvaecpwilg