Lineage for d3ieba_ (3ieb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1566369Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1567089Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 1567090Protein automated matches [190292] (24 species)
    not a true protein
  7. 1567221Species Vibrio cholerae [TaxId:666] [189015] (2 PDB entries)
  8. 1567226Domain d3ieba_: 3ieb A: [178266]
    automated match to d1kv8a_
    complexed with gol, so4

Details for d3ieba_

PDB Entry: 3ieb (more details), 2.1 Å

PDB Description: Crystal structure of 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
PDB Compounds: (A:) Hexulose-6-phosphate synthase SgbH

SCOPe Domain Sequences for d3ieba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ieba_ c.1.2.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
tkpmiqialdqtnltdavavasnvasyvdvievgtilafaegmkavstlrhnhpnhilvc
dmkttdggailsrmafeagadwitvsaaahiatiaackkvadelngeiqieiygnwtmqd
akawvdlgitqaiyhrsrdaelagigwttddldkmrqlsalgielsitggivpediylfe
giktktfiagralagaegqqtaaalreqidrfw

SCOPe Domain Coordinates for d3ieba_:

Click to download the PDB-style file with coordinates for d3ieba_.
(The format of our PDB-style files is described here.)

Timeline for d3ieba_: