SCOPe 2.07: Domain d1beaa_: 1bea A:

Lineage for d1beaa_ (1bea A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)

6. Protein Hageman factor/amylase inhibitor [47713] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [47714] (2 PDB entries)

8. Domain d1beaa_: 1bea A: [17826]

Details for d1beaa_

PDB Entry: 1bea, 1.95 Å

PDB Description: bifunctional hageman factor/amylase inhibitor from maize

PDB Compounds: (A:) bifunctional amylase/serine protease inhibitor

SCOPe Domain Sequences for d1beaa_:

Sequence; same for both SEQRES and ATOM records:

>d1beaa_ a.52.1.2 (A:) Hageman factor/amylase inhibitor {Maize (Zea mays) [TaxId: 4577]}
scvpgwaiphnplpscrwyvtsrtcgigprlpwpelkrrccreladipaycrctalsilm
dgaippgpdaqlegrledlpgcprevqrgfaatlvteaecnlatisgvaecpwilg

Timeline for d1beaa_:

• d1beaa_ first appeared (with stable ids) in SCOP 1.55, called d1bea__
  
• d1beaa_ appears in SCOPe 2.06
  
• d1beaa_ appears in the current release, SCOPe 2.08