Lineage for d1beaa_ (1bea A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714923Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins)
  6. 2714930Protein Hageman factor/amylase inhibitor [47713] (1 species)
  7. 2714931Species Maize (Zea mays) [TaxId:4577] [47714] (2 PDB entries)
  8. 2714932Domain d1beaa_: 1bea A: [17826]

Details for d1beaa_

PDB Entry: 1bea (more details), 1.95 Å

PDB Description: bifunctional hageman factor/amylase inhibitor from maize
PDB Compounds: (A:) bifunctional amylase/serine protease inhibitor

SCOPe Domain Sequences for d1beaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beaa_ a.52.1.2 (A:) Hageman factor/amylase inhibitor {Maize (Zea mays) [TaxId: 4577]}
scvpgwaiphnplpscrwyvtsrtcgigprlpwpelkrrccreladipaycrctalsilm
dgaippgpdaqlegrledlpgcprevqrgfaatlvteaecnlatisgvaecpwilg

SCOPe Domain Coordinates for d1beaa_:

Click to download the PDB-style file with coordinates for d1beaa_.
(The format of our PDB-style files is described here.)

Timeline for d1beaa_: