Class a: All alpha proteins [46456] (290 folds) |
Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily) 4 helices; folded leaf; right-handed superhelix |
Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) can be classified as disulfide-rich |
Family a.52.1.2: Proteinase/alpha-amylase inhibitors [47708] (3 proteins) |
Protein Hageman factor/amylase inhibitor [47713] (1 species) |
Species Maize (Zea mays) [TaxId:4577] [47714] (2 PDB entries) |
Domain d1beaa_: 1bea A: [17826] |
PDB Entry: 1bea (more details), 1.95 Å
SCOPe Domain Sequences for d1beaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1beaa_ a.52.1.2 (A:) Hageman factor/amylase inhibitor {Maize (Zea mays) [TaxId: 4577]} scvpgwaiphnplpscrwyvtsrtcgigprlpwpelkrrccreladipaycrctalsilm dgaippgpdaqlegrledlpgcprevqrgfaatlvteaecnlatisgvaecpwilg
Timeline for d1beaa_: