SCOPe 2.05: Domain d3ibxd_: 3ibx D:

Lineage for d3ibxd_ (3ibx D:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (8 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [189118] (2 PDB entries)

8. Domain d3ibxd_: 3ibx D: [178229]
   automated match to d1to9b_

Details for d3ibxd_

PDB Entry: 3ibx, 2.4 Å

PDB Description: crystal structure of f47y variant of tena (hp1287) from helicobacter pylori

PDB Compounds: (D:) Putative thiaminase II

SCOPe Domain Sequences for d3ibxd_:

Sequence, based on SEQRES records:

>d3ibxd_ a.132.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 210]}
tmqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylylleyakvfalgv
vkacdeavmrefsnaiqdilnnemsihnhyirelqitqkelqnacptlanksytsymlae
gfkgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwnin
lldsltlasskqeieklkeifittseyeylfwdmayqs

Sequence, based on observed residues (ATOM records):

>d3ibxd_ a.132.1.0 (D:) automated matches {Helicobacter pylori [TaxId: 210]}
tmqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylylleyakvfalgv
vkacdeavmrefsnaiqdilnmsihnhyirelqitqkelqnacptlanksytsymlaegf
kgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwninll
dsltlasskqeieklkeifittseyeylfwdmayqs

Timeline for d3ibxd_:

• d3ibxd_ first appeared in SCOPe 2.01
  
• d3ibxd_ appears in SCOPe 2.04
  
• d3ibxd_ is called d3ibxd1 in SCOPe 2.06
  
• d3ibxd_ appears in the current release, SCOPe 2.08, called d3ibxd1