![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (9 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [189118] (2 PDB entries) |
![]() | Domain d3ibxd1: 3ibx D:1-217 [178229] Other proteins in same PDB: d3ibxa2, d3ibxd2 automated match to d1to9b_ |
PDB Entry: 3ibx (more details), 2.4 Å
SCOPe Domain Sequences for d3ibxd1:
Sequence, based on SEQRES records: (download)
>d3ibxd1 a.132.1.0 (D:1-217) automated matches {Helicobacter pylori [TaxId: 210]} mqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylylleyakvfalgvv kacdeavmrefsnaiqdilnnemsihnhyirelqitqkelqnacptlanksytsymlaeg fkgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwninl ldsltlasskqeieklkeifittseyeylfwdmayqs
>d3ibxd1 a.132.1.0 (D:1-217) automated matches {Helicobacter pylori [TaxId: 210]} mqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylylleyakvfalgvv kacdeavmrefsnaiqdilnmsihnhyirelqitqkelqnacptlanksytsymlaegfk gsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwninlld sltlasskqeieklkeifittseyeylfwdmayqs
Timeline for d3ibxd1: