Lineage for d3ibxd1 (3ibx D:1-217)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011656Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2011657Protein automated matches [190172] (9 species)
    not a true protein
  7. 2011658Species Helicobacter pylori [TaxId:210] [189118] (2 PDB entries)
  8. 2011660Domain d3ibxd1: 3ibx D:1-217 [178229]
    Other proteins in same PDB: d3ibxa2, d3ibxd2
    automated match to d1to9b_

Details for d3ibxd1

PDB Entry: 3ibx (more details), 2.4 Å

PDB Description: Crystal structure of F47Y variant of TenA (HP1287) from Helicobacter pylori
PDB Compounds: (D:) Putative thiaminase II

SCOPe Domain Sequences for d3ibxd1:

Sequence, based on SEQRES records: (download)

>d3ibxd1 a.132.1.0 (D:1-217) automated matches {Helicobacter pylori [TaxId: 210]}
mqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylylleyakvfalgvv
kacdeavmrefsnaiqdilnnemsihnhyirelqitqkelqnacptlanksytsymlaeg
fkgsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwninl
ldsltlasskqeieklkeifittseyeylfwdmayqs

Sequence, based on observed residues (ATOM records): (download)

>d3ibxd1 a.132.1.0 (D:1-217) automated matches {Helicobacter pylori [TaxId: 210]}
mqvsqylyqnaqsiwgdcishpfvqgigrgtlerdkfrfyiiqdylylleyakvfalgvv
kacdeavmrefsnaiqdilnmsihnhyirelqitqkelqnacptlanksytsymlaegfk
gsikevaaavlscgwsylviaqnlsqipnalehafyghwikgysskefqacvnwninlld
sltlasskqeieklkeifittseyeylfwdmayqs

SCOPe Domain Coordinates for d3ibxd1:

Click to download the PDB-style file with coordinates for d3ibxd1.
(The format of our PDB-style files is described here.)

Timeline for d3ibxd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ibxd2