Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (36 species) not a true protein |
Species Guinea pig (Cavia porcellus) [TaxId:10141] [189281] (2 PDB entries) |
Domain d3hyua_: 3hyu A: [177949] automated match to d1bz1a_ complexed with hem, po4 |
PDB Entry: 3hyu (more details), 1.67 Å
SCOPe Domain Sequences for d3hyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hyua_ a.1.1.2 (A:) automated matches {Guinea pig (Cavia porcellus) [TaxId: 10141]} vlsaadknnvkttwdkigghaaeyvaegltrmftsfpttktyfhhidvspgsgdikahgk kvadalttavghlddlptalstlsdvhahklrvdpvnfkflnhcllvtlaahlgadftps ihasldkffasvstvltskyr
Timeline for d3hyua_: