SCOPe 2.02: Domain d3hyua_: 3hyu A:

Lineage for d3hyua_ (3hyu A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (36 species)
   not a true protein

7. Species Guinea pig (Cavia porcellus) [TaxId:10141] [189281] (2 PDB entries)

8. Domain d3hyua_: 3hyu A: [177949]
   automated match to d1bz1a_
   complexed with hem, po4

Details for d3hyua_

PDB Entry: 3hyu, 1.67 Å

PDB Description: Crystal structure of the altitude adapted hemoglobin of guinea pig.

PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3hyua_:

Sequence; same for both SEQRES and ATOM records:

>d3hyua_ a.1.1.2 (A:) automated matches {Guinea pig (Cavia porcellus) [TaxId: 10141]}
vlsaadknnvkttwdkigghaaeyvaegltrmftsfpttktyfhhidvspgsgdikahgk
kvadalttavghlddlptalstlsdvhahklrvdpvnfkflnhcllvtlaahlgadftps
ihasldkffasvstvltskyr

Timeline for d3hyua_:

• d3hyua_ first appeared in SCOPe 2.01
  
• d3hyua_ appears in SCOPe 2.03
  
• d3hyua_ appears in the current release, SCOPe 2.08