![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
![]() | Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
![]() | Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
![]() | Protein automated matches [191061] (11 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188950] (1 PDB entry) |
![]() | Domain d3hykb1: 3hyk B:1-117 [177946] Other proteins in same PDB: d3hyka2, d3hykb2, d3hykc2 automated match to d1f80a_ complexed with a3p, cl, mg |
PDB Entry: 3hyk (more details), 2.31 Å
SCOPe Domain Sequences for d3hykb1:
Sequence, based on SEQRES records: (download)
>d3hykb1 d.150.1.0 (B:1-117) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mivgigidiielnriekmldgklkfmeriltenernvakglkgsrltefvagrfaakeay skavgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvless
>d3hykb1 d.150.1.0 (B:1-117) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mivgigidiielnriekmldkfmeriltenernvakglkgsrltefvagrfaakeayska vgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvless
Timeline for d3hykb1:
![]() Domains from other chains: (mouse over for more information) d3hyka1, d3hyka2, d3hykc1, d3hykc2 |