Lineage for d3hyka1 (3hyk A:1-118)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594189Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2594190Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2594223Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 2594224Protein automated matches [191061] (11 species)
    not a true protein
  7. 2594225Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188950] (1 PDB entry)
  8. 2594226Domain d3hyka1: 3hyk A:1-118 [177945]
    Other proteins in same PDB: d3hyka2, d3hykb2, d3hykc2
    automated match to d1f80a_
    complexed with a3p, cl, mg

Details for d3hyka1

PDB Entry: 3hyk (more details), 2.31 Å

PDB Description: 2.31 angstrom resolution crystal structure of a holo-(acyl-carrier- protein) synthase from bacillus anthracis str. ames in complex with coa (3',5'-adp)
PDB Compounds: (A:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3hyka1:

Sequence, based on SEQRES records: (download)

>d3hyka1 d.150.1.0 (A:1-118) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivgigidiielnriekmldgklkfmeriltenernvakglkgsrltefvagrfaakeay
skavgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvlesss

Sequence, based on observed residues (ATOM records): (download)

>d3hyka1 d.150.1.0 (A:1-118) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivgigidiielnriekmldkfmeriltenernvakglkgsrltefvagrfaakeayska
vgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvlesss

SCOPe Domain Coordinates for d3hyka1:

Click to download the PDB-style file with coordinates for d3hyka1.
(The format of our PDB-style files is described here.)

Timeline for d3hyka1: