SCOPe 2.01: Domain d3hvfa_: 3hvf A:

Lineage for d3hvfa_ (3hvf A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (27 PDB entries)

8. Domain d3hvfa_: 3hvf A: [177864]
   automated match to d1iysa_
   complexed with pnk

Details for d3hvfa_

PDB Entry: 3hvf, 1.5 Å

PDB Description: x-ray crystallographic structure of ctx-m-9 s70g in complex with hydrolyzed benzylpenicillin

PDB Compounds: (A:) CTX-M-9 extended-spectrum beta-lactamase

SCOPe Domain Sequences for d3hvfa_:

Sequence; same for both SEQRES and ATOM records:

>d3hvfa_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

Timeline for d3hvfa_:

• d3hvfa_ is new in SCOPe 2.01-stable
  
• d3hvfa_ appears in SCOPe 2.02
  
• d3hvfa_ appears in the current release, SCOPe 2.08