![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein automated matches [190329] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187151] (3 PDB entries) |
![]() | Domain d3hupb_: 3hup B: [177851] automated match to d1fm5a_ complexed with cl, na |
PDB Entry: 3hup (more details), 1.37 Å
SCOPe Domain Sequences for d3hupb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hupb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
Timeline for d3hupb_: