Lineage for d3hupa_ (3hup A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048472Protein automated matches [190329] (5 species)
    not a true protein
  7. 1048478Species Human (Homo sapiens) [TaxId:9606] [187151] (3 PDB entries)
  8. 1048479Domain d3hupa_: 3hup A: [177850]
    automated match to d1fm5a_
    complexed with cl, na

Details for d3hupa_

PDB Entry: 3hup (more details), 1.37 Å

PDB Description: High-resolution structure of the extracellular domain of human CD69
PDB Compounds: (A:) early activation antigen cd69

SCOPe Domain Sequences for d3hupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hupa_ d.169.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dshvsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagr
eehwvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpy
k

SCOPe Domain Coordinates for d3hupa_:

Click to download the PDB-style file with coordinates for d3hupa_.
(The format of our PDB-style files is described here.)

Timeline for d3hupa_: