Lineage for d3hqxa_ (3hqx A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424651Species Acinetobacter sp. [TaxId:62977] [188944] (1 PDB entry)
  8. 2424652Domain d3hqxa_: 3hqx A: [177787]
    automated match to d2oyza1

Details for d3hqxa_

PDB Entry: 3hqx (more details), 1.66 Å

PDB Description: Crystal structure of protein of unknown function (DUF1255,PF06865) from Acinetobacter sp. ADP1
PDB Compounds: (A:) UPF0345 protein ACIAD0356

SCOPe Domain Sequences for d3hqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hqxa_ b.82.1.0 (A:) automated matches {Acinetobacter sp. [TaxId: 62977]}
saqfdhvtvikksnvyfgglcishtvqfedgtkktlgvilpteqpltfethvpermeiis
gecrvkiadsteselfragqsfyvpgnslfkietdevldyvchle

SCOPe Domain Coordinates for d3hqxa_:

Click to download the PDB-style file with coordinates for d3hqxa_.
(The format of our PDB-style files is described here.)

Timeline for d3hqxa_: