Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (5 species) not a true protein |
Species Acinetobacter sp. [TaxId:62977] [188944] (1 PDB entry) |
Domain d3hqxa_: 3hqx A: [177787] automated match to d2oyza1 |
PDB Entry: 3hqx (more details), 1.66 Å
SCOPe Domain Sequences for d3hqxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hqxa_ b.82.1.0 (A:) automated matches {Acinetobacter sp. [TaxId: 62977]} saqfdhvtvikksnvyfgglcishtvqfedgtkktlgvilpteqpltfethvpermeiis gecrvkiadsteselfragqsfyvpgnslfkietdevldyvchle
Timeline for d3hqxa_: