Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188939] (9 PDB entries) |
Domain d3hpnc_: 3hpn C: [177764] automated match to d1kgya_ |
PDB Entry: 3hpn (more details), 2.52 Å
SCOPe Domain Sequences for d3hpnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hpnc_ b.18.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwvy rgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtiap deitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc
Timeline for d3hpnc_: