Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) |
Family d.118.1.0: automated matches [191348] (1 protein) not a true family |
Protein automated matches [190280] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [189356] (2 PDB entries) |
Domain d3hmba_: 3hmb A: [177692] automated match to d1yb0a1 complexed with zn; mutant |
PDB Entry: 3hmb (more details), 2.7 Å
SCOPe Domain Sequences for d3hmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hmba_ d.118.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mvniiqkfipvgannrpgyamkpkyitvhntantavgadaaaharylknpdtttswhftv ddkeiyqhlplnengwhagdgngsgnrasigieicenadgdfakatanaqwliktlmaeh nislanvvphkywsgkecprklldkwdsfkagig
Timeline for d3hmba_: