Lineage for d3hmba_ (3hmb A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2973039Family d.118.1.0: automated matches [191348] (1 protein)
    not a true family
  6. 2973040Protein automated matches [190280] (10 species)
    not a true protein
  7. 2973044Species Bacillus subtilis [TaxId:1423] [189356] (3 PDB entries)
  8. 2973048Domain d3hmba_: 3hmb A: [177692]
    Other proteins in same PDB: d3hmbb2
    automated match to d1yb0a1
    complexed with zn; mutant

Details for d3hmba_

PDB Entry: 3hmb (more details), 2.7 Å

PDB Description: mutant endolysin from bacillus subtilis
PDB Compounds: (A:) N-acetylmuramoyl-L-alanine amidase xlyA

SCOPe Domain Sequences for d3hmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hmba_ d.118.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mvniiqkfipvgannrpgyamkpkyitvhntantavgadaaaharylknpdtttswhftv
ddkeiyqhlplnengwhagdgngsgnrasigieicenadgdfakatanaqwliktlmaeh
nislanvvphkywsgkecprklldkwdsfkagig

SCOPe Domain Coordinates for d3hmba_:

Click to download the PDB-style file with coordinates for d3hmba_.
(The format of our PDB-style files is described here.)

Timeline for d3hmba_: